Protein Info for Psyr_2139 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Kef-type potassium/proton antiporter, CPA2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 602 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 297 to 317 (21 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details TIGR00932: transporter, monovalent cation:proton antiporter-2 (CPA2) family" amino acids 15 to 286 (272 residues), 285.9 bits, see alignment E=1.8e-89 PF00999: Na_H_Exchanger" amino acids 17 to 379 (363 residues), 215.6 bits, see alignment E=1.5e-67 PF02254: TrkA_N" amino acids 409 to 522 (114 residues), 91.9 bits, see alignment E=5.5e-30 PF27452: KefB_C" amino acids 528 to 598 (71 residues), 62.2 bits, see alignment E=6.8e-21

Best Hits

Swiss-Prot: 45% identical to KEFB_PECAS: Glutathione-regulated potassium-efflux system protein KefB (kefB) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 100% identity to psb:Psyr_2139)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUJ0 at UniProt or InterPro

Protein Sequence (602 amino acids)

>Psyr_2139 Kef-type potassium/proton antiporter, CPA2 family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPHEGSLLQVAVVFLLAAVLTVPLAKRLKLGAVIGYLFAGVVIGPSVLGLIGDTESVSHI
SELGVVLLLFIIGLELSPKRLWVMRKSVFGVGMAQVLLTGLIIGGVAFAAFGQSLNTAAI
LGLGLALSSTAFGLQSLAERKQLNSPHGRMAFAILLFQDIAAIPLIAMVPFLAGADHAMD
TGESINHGLRVLGSIAIVVIGGRYLLRPVFRIVAKTKIQEVSTATALLVVIGTAWLMELV
GVSMALGAFLAGLLLADSEYRHELEAQIEPFKGLLLGLFFISVGMGANVGLLLSSPLIVL
GLTLLLIAIKLPMLFLIGRTLGELNNRSALQLGLVLAAGGEFAFVVFKIGSAQGLFEAGL
YDMLVLTITLSMAVTPLLFIALARWIKPKVKPVEVPEEYRDIQTDKPRVVIAGMGRMGQI
VARILRAQKIPFIALDTAVESIEFSRSFGNVPVFYGDPLRPEILRAAKVDEAEYFVIATD
DPDTNIKTAELIRKLYPHMKIIARARNRQHVHRLMDLGAHAVRETFYSSLEMSRQTLMGL
GLSETQADARISRFKRHDEQVLAAQHEVYDDDAKVLQTAREARADLAQLFEADRLDEEAA
KS