Protein Info for Psyr_2137 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: molybdopterin molybdochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF03453: MoeA_N" amino acids 9 to 170 (162 residues), 161 bits, see alignment E=2.9e-51 TIGR00177: molybdenum cofactor synthesis domain" amino acids 180 to 313 (134 residues), 102.3 bits, see alignment E=1.1e-33 PF00994: MoCF_biosynth" amino acids 183 to 317 (135 residues), 107.8 bits, see alignment E=5.9e-35 PF03454: MoeA_C" amino acids 333 to 398 (66 residues), 62.9 bits, see alignment E=4.1e-21

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to psb:Psyr_2137)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUJ2 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Psyr_2137 molybdopterin molybdochelatase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSHEPKTLLPVEDAIARLLKMAEATPITERQRVSLADAEGRVLAVDLVSTLDLPPWPNSA
MDGYALRAADWRGEPLSVSQRIFAGQAPEPLAPGTCARIFTGAPMPEGADCVEMQENAEV
QADQRVRFNEPLGAGQNIRPQGQETRVGDTVLAAGTRLGPIELGLAASLGLAELEVIRRV
RVAVLSTGDELIEPGQPLGPGQIYNSNRVLLCSWLKRLECEVVDAGILPDDLDKTRAALA
NLQGVDLILSTGGVSVGEADFLGHALREEGELTLWKLAIKPGKPLTFGHFRGVPVIGLPG
NPASTLVTFALLARAYLLRRQGVIDVAPLQFPVPAGFVWTRPGNRREYLRGRLEQGRAVA
YRNQSSGVLRSAAWADGLIEVREGSTVAEGDWVNFIPLSEVLG