Protein Info for Psyr_2126 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 4-carboxymuconolactone decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 TIGR02425: 4-carboxymuconolactone decarboxylase" amino acids 4 to 124 (121 residues), 189.8 bits, see alignment E=7.9e-61 PF02627: CMD" amino acids 36 to 119 (84 residues), 93.7 bits, see alignment E=2.8e-31

Best Hits

Swiss-Prot: 52% identical to DC4C_ACIAD: 4-carboxymuconolactone decarboxylase (pcaC) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 100% identity to psb:Psyr_2126)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUK3 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Psyr_2126 4-carboxymuconolactone decarboxylase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTEDERYEAGMQVRRAVLGDAHVDNSLSKLTPFNEEFQEMITRHAWGDIWTRPGLPRHTR
SLITIAMLIGMNREGELRLHLKAAKNNGVTREEIKEVLMQSAIYCGIPAANATFHLAEAV
WDEMGVESLQDN