Protein Info for Psyr_2122 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: protocatechuate 3,4-dioxygenase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF12391: PCDO_beta_N" amino acids 12 to 43 (32 residues), 58 bits, see alignment 5.8e-20 TIGR02422: protocatechuate 3,4-dioxygenase, beta subunit" amino acids 17 to 238 (222 residues), 353.3 bits, see alignment E=2.8e-110 PF00775: Dioxygenase_C" amino acids 48 to 230 (183 residues), 206.1 bits, see alignment E=3.2e-65

Best Hits

Swiss-Prot: 87% identical to PCXB_PSEPU: Protocatechuate 3,4-dioxygenase beta chain (pcaH) from Pseudomonas putida

KEGG orthology group: K00449, protocatechuate 3,4-dioxygenase, beta subunit [EC: 1.13.11.3] (inferred from 100% identity to psb:Psyr_2122)

MetaCyc: 87% identical to protocatechuate 3,4-dioxygenase beta subunit (Pseudomonas putida)
Protocatechuate 3,4-dioxygenase. [EC: 1.13.11.3]; 1.13.11.- [EC: 1.13.11.3]

Predicted SEED Role

"Protocatechuate 3,4-dioxygenase beta chain (EC 1.13.11.3)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 1.13.11.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.3

Use Curated BLAST to search for 1.13.11.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUK7 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Psyr_2122 protocatechuate 3,4-dioxygenase, beta subunit (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSAADNSRFVIRDRNWHPKALTPDYKTSILRSPRQALVSIPQSISETTGPDFSHLKFGQH
DNDLLLNFNNGGLPIGERILLAGRVCDQYGKPIPHTLVEIWQANAGGRYRHKRDAYLAPI
DPNFGGVGRALTDSEGNYSFRTVKPGPYPWRNGPNDWRPAHIHVSISGPSIATRLITQLY
FEGDPLIPICPIVKAIANPDAVQSLIARLDLGMGNPMDCLAYRFDIVLRGQRKTHFENC