Protein Info for Psyr_2108 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 23S rRNA m(2)G-2445 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 PF22020: RlmL_1st" amino acids 6 to 61 (56 residues), 66.2 bits, see alignment 5e-22 PF02926: THUMP" amino acids 70 to 156 (87 residues), 61.6 bits, see alignment E=2e-20 PF01170: UPF0020" amino acids 165 to 380 (216 residues), 144.4 bits, see alignment E=9e-46 PF10672: Methyltrans_SAM" amino acids 510 to 701 (192 residues), 71.4 bits, see alignment E=2e-23 PF03602: Cons_hypoth95" amino acids 583 to 670 (88 residues), 30.7 bits, see alignment E=6e-11

Best Hits

Swiss-Prot: 100% identical to RLMKL_PSEU2: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to psb:Psyr_2108)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUM1 at UniProt or InterPro

Protein Sequence (750 amino acids)

>Psyr_2108 23S rRNA m(2)G-2445 methyltransferase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSDRYELFLTCPKGLEGLLAEEATALGLQETREHTSAIRGSADMETAYRLCLWSRLANRV
LLVLKRFPMKDAEDLYHGVLDVEWQDHLESDGTIAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRTPDGERPSVDKINPDLRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAILIRAGWPRIAAEGGALADPMCGVGTFLVEAGMIAADIAPNIKRERWGFSAWLGHVP
ALWRKLHDEALARAEAGLAKTPSWIRGYEADPRLIQPGRNNIERAGLSDWIKVYQGEVAT
FEPRPDQNQKGLVICNPPYGERLGDEASLLYLYQNLGERLRQACLNWEAAVFTGAPDLGK
RMGIRSHKQYSFWNGALPCKLLLIKVTPDQFVTGERRTPEQRQIERENPVEVEVVERKLN
KNGNPIKPEPVVVEQARLSEGGQMFANRLQKNLKLMGKWVRREGIDCYRVYDADMPEYSL
AIDLYHDWVHVQEYAAPKSIDPEKASARLFDALAAIPQALNIDKNRVVIKRRERQSGTKQ
YERQSAQGQFLEVSEGGVKLLVNLTDYLDTGLFLDHRPMRMRIQREASGKRFLNLFAYTA
TASVHAAKGGARSTTSVDLSRTYLDWARRNLSLNGFSDKNRLEQGDVMAWLQANRDEYDL
IFIDPPTFSNSKRMEGIFDVQRDQVELIDLAMARLAPGGVLYFSNNFRKFVLDENLSQRY
AVEDITAHTIDQDFARNGKIHRAWKIMARS