Protein Info for Psyr_2080 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: aminodeoxychorismate synthase, subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04715: Anth_synt_I_N
  • amino acids 13 to 138 (126 residues), 68.2 bits, E=9.5e-23
• TIGR00553: aminodeoxychorismate synthase, component I
  • amino acids 93 to 440 (348 residues), 368.3 bits, E=1.7e-114
• PF00425: Chorismate_bind
  • amino acids 182 to 436 (255 residues), 311.4 bits, E=5.3e-97

Best Hits

KEGG orthology group: K01665, para-aminobenzoate synthetase component I [EC: 2.6.1.85] (inferred from 100% identity to psb:Psyr_2080)

Predicted SEED Role

"Para-aminobenzoate synthase, aminase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 2.6.1.85)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 4-aminobenzoate biosynthesis I (2/2 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• chloramphenicol biosynthesis (1/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

See Q4ZUP9 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Psyr_2080 aminodeoxychorismate synthase, subunit I (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPICSIHPLPYSADPIAFFARIREAPGAVLLDSGRPAAVRGRHDLLSAWPLQELTVADGE
NGATYLQRLRDSLKALGPAQLPDGCELPFAGGLIGYLSYEFGRRLEPLPDQAIDDLQLPE
ARLGLYAWALISDHQEQTSQLIFHPSLAVSERERLIELFSVDIPEPRTEFRLSQPFQASI
SADNYRQAFERIQAYIQAGDCYQVNFAQRFQAQCVGDPWAAYRALRAACPTPFAGYLSLP
GADAMLSLSPERFVRVSTRQVETRPIKGTRPRSADPAQDAALAAELLASEKDRAENLMIV
DLLRNDLGRSCRIGSVKVPELFSLESYPNVHHLVSSVTGELAAGNDALDLIGGSFPGGSI
TGAPKIRAMQIIDELEPTRRSLYCGSLMYLDVRGEMDSSIAIRSLLVKDGQISCWGGGGI
VADSDCEAEYQETFTKVRVLLETLEAL