Protein Info for Psyr_2025 in Pseudomonas syringae pv. syringae B728a ΔmexB
Annotation: Phenylacetic acid degradation-related protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to Y1618_PSEAE: Putative esterase PA1618 (PA1618) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2025)MetaCyc: 53% identical to 1,4-dihydroxy-2-naphthoyl-CoA hydrolase (Escherichia coli K-12 substr. MG1655)
RXN-9311 [EC: 3.1.2.28]
Predicted SEED Role
"FIG002571: 4-hydroxybenzoyl-CoA thioesterase domain protein"
MetaCyc Pathways
- superpathway of chorismate metabolism (42/59 steps found)
- 2-carboxy-1,4-naphthoquinol biosynthesis (1/7 steps found)
- superpathway of menaquinol-8 biosynthesis I (3/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (2/9 steps found)
- superpathway of menaquinol-10 biosynthesis (2/10 steps found)
- superpathway of menaquinol-11 biosynthesis (2/10 steps found)
- superpathway of menaquinol-12 biosynthesis (2/10 steps found)
- superpathway of menaquinol-13 biosynthesis (2/10 steps found)
- superpathway of menaquinol-6 biosynthesis (2/10 steps found)
- superpathway of menaquinol-7 biosynthesis (2/10 steps found)
- superpathway of menaquinol-9 biosynthesis (2/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (1/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (1/9 steps found)
- superpathway of phylloquinol biosynthesis (2/15 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.2.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q4ZUV4 at UniProt or InterPro
Protein Sequence (147 amino acids)
>Psyr_2025 Phenylacetic acid degradation-related protein (Pseudomonas syringae pv. syringae B728a ΔmexB) MSIWRQAPDIEALMAAQKNTIGEVLDIRFEAFTDDSLTASMVVDQRTHQPFGLLHGGASV VLAESLGSMASYLIVDPSKYFCVGLEVNANHLRGVRSGRVTGVVRPVHIGRTTHVWDIRI SNDEGKPSCISRLTVAVVAHGKEPPVN