Protein Info for Psyr_2011 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 4 to 472 (469 residues), 538.8 bits, E=5.4e-166
• PF03486: HI0933_like
  • amino acids 5 to 48 (44 residues), 23.8 bits, 1.1e-08
• PF07992: Pyr_redox_2
  • amino acids 5 to 334 (330 residues), 244.9 bits, E=7.7e-76
• PF01134: GIDA
  • amino acids 6 to 59 (54 residues), 27.5 bits, 9.9e-10
• PF00890: FAD_binding_2
  • amino acids 6 to 49 (44 residues), 35.1 bits, 5.5e-12
• PF12831: FAD_oxidored
  • amino acids 6 to 37 (32 residues), 29.1 bits, see alignment (E = 4.2e-10)
• PF00070: Pyr_redox
  • amino acids 183 to 256 (74 residues), 62.6 bits, E=2.4e-20
• PF02852: Pyr_redox_dim
  • amino acids 353 to 462 (110 residues), 141.3 bits, E=8.4e-45

Best Hits

Swiss-Prot: 87% identical to DLDH2_PSEPU: Dihydrolipoyl dehydrogenase (lpdG) from Pseudomonas putida

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to psb:Psyr_2011)

MetaCyc: 48% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• folate transformations III (E. coli) (9/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• folate transformations II (plants) (10/11 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• glycine degradation (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• folate transformations I (9/13 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)
• photorespiration II (6/10 steps found)
• photorespiration I (5/9 steps found)
• photorespiration III (5/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (5/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

See Q4ZUW8 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Psyr_2011 dihydrolipoamide dehydrogenase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSQKFDVVVIGAGPGGYVAAIKAAQLGLKTACIEKYQDKEGKLALGGTCLNVGCIPSKAL
LDSSWKFYEAKNGFSVHGISTSDVSIDVPAMIGRKSTIVKGLTGGVASLFKANGVTTLQG
HGKLLAGKKVELTAADGTVEIIEADHVILASGSRPIDIPPAPVDQKIIVDSTGALEFQQV
PQRLGVIGAGVIGLELGSVWARLGAQVTVLEALDKFIPAADEAVSKEALKTFNKQGLDIK
LGARVTGSKVEGEQVVVSYTDAAGEQSITFDRLIVAVGRRPVTTDLLASDSGVDLDERGF
IYVDDYCTTSVPGVYAIGDVVRGLMLAHKASEEGIMVVERIKGHKAQMNYNLVPSVIYTH
PEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTGGFVKIIADAKTDRVLGVHVI
GPSAAELVQQGAIAMEFGTSAEDIGMMVFSHPTLSEALHEAALAVNGGAIHIQNRKKR