Protein Info for Psyr_1921 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Alpha/beta hydrolase fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 70 to 338 (269 residues), 47.3 bits, see alignment E=3.3e-16 PF12697: Abhydrolase_6" amino acids 71 to 336 (266 residues), 32.5 bits, see alignment E=2.2e-11 PF12146: Hydrolase_4" amino acids 94 to 338 (245 residues), 53.1 bits, see alignment E=4.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1921)

Predicted SEED Role

"Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV57 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Psyr_1921 Alpha/beta hydrolase fold protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKRIASAALFIASCTTALMVSAAPLPASSAANIDGVEIHTVTLKTDAMKMALWRDSPKGT
HTQTMKESQVVLFIHGATISGNLSAGYAIDGYSWAQDVANSGREAWVVDLPGYGRSDDYS
EMREASPHANGESVGNAKSLVPVIDAAVDYVLKFTGAKKLTIIATSRGAIPVGYYLSAHG
EKVDKVVFNSPIVRRDTTSPEIVRGLFGSAERPDKSFYEIPVDKRLSMIEEDRPAGTETQ
LEQGFIKNWPGDAALERAHQKNMIKVPGGFAQDIYDAWHGVYWDPATITVPVLITRGDYD
HVLTTAADIDWLYTHLSNASSKRYVLIDKGTHAMLFEKKRFELYREVRVFLEGSYNRLSL
ACSFCGGRN