Protein Info for Psyr_1865 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details PF00884: Sulfatase" amino acids 311 to 590 (280 residues), 194.3 bits, see alignment E=1.5e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1865)

Predicted SEED Role

"Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVB0 at UniProt or InterPro

Protein Sequence (695 amino acids)

>Psyr_1865 Sulfatase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MAKTDAQIHRQARLQNPTVKSHLAYILLSGFALMVMYTLLRIGLLVYNREMIGDTPASTF
LEALFNGTRFDLRLTMYLLIPLVLSLFSARAMAARGFFRFWLTLVGSITLFFGLMEMDFY
REFHQRLNGLVFQYVKEDPKTVLSMLWYGFPVVRYLLAWAVVTWLLSLVFKGIDRATRPR
VAAKTSPQATRSVAPWYARAGVFVLVLLVMVVCIRGTLRQGPPLRWGDAYTTDSNFANQL
GLNGTLTLITAAKSRMSEDRDNIWKATLPQAEAQQTVRDMLLTPNDKLVEPDIAAVRRDF
TPPAENTLPIRNVVVILMESFAGHSVGALGNDANITPYFDKLSKEGLLFDHFFSNGTHTH
QGMFATMACFPNLPGFEYLMQTPEGSHKLSGLPQLLSTGRNYDDVYVYNGNFAWDNQSGF
FSNQGMTNFVGREDFVNPVFSDPTWGVSDQDMFDRGAQELKARQDGKPFYALLQTLSNHT
PYALPDPLPVERVTGHGSLDEHLTAMRYADWALGQFFEKAKKEPYYKNTLFVVLGDHGFG
NDKQLTEMDLGRFNVPLLLIGPGVQEKFGQRSSIVGTQVDVVPTIMGRLGGLNRNQCWGR
DLLNLPEGDKGFGVIKPSGSEQVVAIISGNRILIEPTEMPAKLLTYTLGAKPHAEEVPDA
PDTQELKRKLESFLQTATKSLLDNTAGVEASKNRN