Protein Info for Psyr_1864 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: spermidine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00417: spermidine synthase
  • amino acids 5 to 275 (271 residues), 350.4 bits, E=3e-109
• PF17284: Spermine_synt_N
  • amino acids 10 to 54 (45 residues), 51.8 bits, 9e-18
• PF01564: Spermine_synth
  • amino acids 57 to 237 (181 residues), 223.9 bits, E=1.9e-70
• PF08241: Methyltransf_11
  • amino acids 81 to 186 (106 residues), 21.3 bits, E=5.2e-08

Best Hits

Swiss-Prot: 97% identical to SPEE_PSESM: Polyamine aminopropyltransferase (speE) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to psb:Psyr_1864)

MetaCyc: 59% identical to spermidine synthase (Escherichia coli K-12 substr. MG1655)
Spermidine synthase. [EC: 2.5.1.16]; 2.5.1.- [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• superpathway of polyamine biosynthesis II (7/8 steps found)
• aminopropylcadaverine biosynthesis (3/3 steps found)
• spermidine biosynthesis I (2/2 steps found)
• L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

See Q4ZVB1 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Psyr_1864 spermidine synthase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSDYQETLYEGYGQRFRMEKMLHEVRTDHQHLVIFQNPRMGRVMALDGVIQTTEADEFIY
HEMLTHVPILAHGAAKRVLIIGGGDGGMLREVAKHMSVEHITMVEIDATVVEMCKEYLPN
HSSGAFDDSRLNLVIDDGMRFVATTEEKFDVIISDSTDPIGPGEVLFSENFYQACHRCLN
EGGILVTQNGTPFMQLSGVQTTAGRMNGLFADWHFYHAAIPTYIGGAMTFAWGSTDKSYR
KLPLETLRQRFSGSGIVTRYYNPEVHIGAFALPQYVLQAVGKASND