Protein Info for Psyr_1791 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: HAD-superfamily hydrolase, subfamily IA, variant 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR01428: haloacid dehalogenase, type II" amino acids 10 to 209 (200 residues), 142.7 bits, see alignment E=1.4e-45 PF00702: Hydrolase" amino acids 12 to 198 (187 residues), 48.9 bits, see alignment E=1.6e-16 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 94 to 196 (103 residues), 54.3 bits, see alignment E=1.9e-18 PF13419: HAD_2" amino acids 101 to 204 (104 residues), 26 bits, see alignment E=1.5e-09 PF13242: Hydrolase_like" amino acids 161 to 234 (74 residues), 24.9 bits, see alignment E=2.3e-09

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 100% identity to psb:Psyr_1791)

Predicted SEED Role

"Haloacid dehalogenase, type II (EC 3.8.1.2)" (EC 3.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.2

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVI4 at UniProt or InterPro

Protein Sequence (240 amino acids)

>Psyr_1791 HAD-superfamily hydrolase, subfamily IA, variant 2 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MARLEQIGFLGFDVFGTVVDWRNGVARAAAPFLQRHGVDVDPLDFADQWRGLYQPSMQRV
RAGERPYVTLDVLNRESLETVLARHEVDFGSIPDAELVELNKAWERLDPWPDSVAGLSRL
KRRFSIGTLSNGHIAGMLNLAKFGGLPWDVIVGAEIAGTYKPMPQTYLKSAKAVGLEPHC
VAMVAAHNADLTAARANGFKTVFVRRPAEHGPGQTSDLSAEQDWDVIVDSLTEAADALDC