Protein Info for Psyr_1784 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF07715: Plug" amino acids 77 to 176 (100 residues), 71.8 bits, see alignment E=6.3e-24 TIGR01783: TonB-dependent siderophore receptor" amino acids 79 to 717 (639 residues), 376.2 bits, see alignment E=1.8e-116 PF00593: TonB_dep_Rec_b-barrel" amino acids 255 to 682 (428 residues), 199.7 bits, see alignment E=1.6e-62

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to psb:Psyr_1784)

Predicted SEED Role

"Outer membrane ferripyoverdine receptor" in subsystem Siderophore Pyoverdine or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVJ1 at UniProt or InterPro

Protein Sequence (717 amino acids)

>Psyr_1784 TonB-dependent siderophore receptor (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSGQQSQSRNRFTPGLLAMGIWAATTQAALGAEEQPATTMELGATQISSDQLGSTTEGSQ
SYTTGPMQTATKLPLTIRETPQAVTVVTRQRMDDQAMTSINDVVRYTPGLFLDQSSGPGR
QTYTSRGFDIDNIMYDGLPASYSGYTAGVQPNLAMFDHVEVIRGATGLATGSGNPSAAIN
MVRKRPTAVPQVTLTGTVGSWDDYRGVFDASGPLNDSRTVRGRIVGSYQDANSFRDKEKS
DHGVFYGVVEADLSDATTATLGLSRQEDQTNYFWGGLPLGVDGHHLNLPRSTYSGSDWEN
KKIQIDTMFGELEHRFDNDWKLRVAGSSSSLDGLFSGTYLSRYNGPLETTAYQSRPEEQQ
SAFDVYASGPVEAFGRTHEVVVGTSRRVYDQTSKEYSPYDTGLPIAAPKPDFVRNGKTHS
IATQDAVYLTTRLSLADPLTLILGGRLDWYDYDDRVGDEDYKVTRNLTRYAGLIYKLDEH
HSLYTSYTDVFQPQSAQDLSGKVLKPVVGENYEVGIKGEYFNGALNTSLAVFQIDQKNLK
TQSPTQAGCAVLTCYDAAGLVRSQGIEMELQGALTENWQVGAGYTYARTHYIKDADPANK
NQQFNTDTPEHLFKVSTVYRLQGALEKIRVGGNVYWQSRMYNDIALTDGSYRLEQGSYAV
ADLMAGYQVSKNLDLQLNANNIFDRTYYTAIGASSVWGSTDVYGNPRSYALTAKYSF