Protein Info for Psyr_1725 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF204

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 74 (17 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details PF02659: Mntp" amino acids 19 to 170 (152 residues), 187.5 bits, see alignment E=6.6e-60

Best Hits

Swiss-Prot: 100% identical to MNTP_PSEU2: Putative manganese efflux pump MntP (mntP) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 98% identity to psp:PSPPH_3559)

MetaCyc: 61% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVP9 at UniProt or InterPro

Protein Sequence (178 amino acids)

>Psyr_1725 Protein of unknown function DUF204 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSTDAFAAALGKGASLHKPRFLEALRTGLIFGAIETITPVIGWGIGQVAARFAESWDHWI
AFTLLLVLGLHMIYNGIKHDDDEEQEKPGQHSFWILAVTAFATSIDALAVGVGLAFVDVN
IVVAALAIGLATTVMVTIGVMLGRVLGTMVGKRAEIIGGIVLIVVGATILYEHLSAAQ