Protein Info for Psyr_1709 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 332 to 351 (20 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 398 to 419 (22 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 381 (363 residues), 162.5 bits, see alignment E=7e-52

Best Hits

Swiss-Prot: 74% identical to ABAQ_ACIBT: Quinolone resistance transporter (abaQ) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1709)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVR5 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Psyr_1709 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSQELRLIRRITFKLIPFLILLYLIAYVDRSAVGFAKLHMGADIGIGDAAYGLGAGLFFI
GYFLLEIPSNLMLERFGARRWFARIMITWGAITIGMAFVQGPHSFYVMRFLLGAAEAGFF
PGVLYYITQWFPVRHRGKILGLFILSQPIAMMITGPVSGGLLGMDGILGLHGWQWLFIVI
GTPAILLTWPVLRWLPDGPQQVKWMDQAEKDWLTGELKKDLEEYGQTRHGNPLHALKDKR
VLLLALFYLPVTLSIYGLGLWLPTLIKQFGGSDLTTGFVSSVPYIFGIIGLLIVPRSSDR
LNDRYGHLAVLYVLGAIGLFCSAWLTMPVAQLAALCVVAFALFSCTAVFWTLPGRFFAGA
SAAAGIALINSVGNLGGYIGPFVIGALKEITGSLASGLYFLSGVMVFGLLLTGIVYHVLE
RKHALPASDFAASARAR