Protein Info for Psyr_1706 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: General substrate transporter:Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 16 to 43 (28 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 304 (16 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 350 to 373 (24 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 362 (345 residues), 132.8 bits, see alignment E=1.5e-42 PF00083: Sugar_tr" amino acids 20 to 193 (174 residues), 42.5 bits, see alignment E=4.2e-15

Best Hits

KEGG orthology group: K08151, MFS transporter, DHA1 family, tetracycline resistance protein (inferred from 100% identity to psb:Psyr_1706)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVR8 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Psyr_1706 General substrate transporter:Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPGGYSKGDTRPPMRFILLILGLDVLGIGLAIPVMPTLIATIWPSSTEHVSLALGVALTL
YSAMQFLCAPLLGALSDCHGRRPILLLALAGMCLGNLMAGFAGSLTVLLIGRAIAGITAA
NIATAMAYIADISEGEQRTHFYGAAGSVIAIALVFGPVIGGGLASYGPHLPFLVAGGLAA
INLLYGYMRLPESLAAEHRRAFEWRRTNPFGSLRGLWSTQGLRPYLLAATCSWFAYGIFQ
SCFVLANQMRYGWSMLEVSYALAALALGMAFAQRVLVRKLTPIMSNQRIIVTGYACCLLG
YGFYTAAASVWLTVVGMCFHAVGLIAEPALRSELSRHASAGHQGELQGGLTSLLSLVGGV
APVIGALIFAGNVGSGQHVLWLGAPFLVSLLMYVLAIGCIQRGRTSAACNG