Protein Info for Psyr_1539 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 626 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 277 to 296 (20 residues), see Phobius details PF16591: HBM" amino acids 30 to 273 (244 residues), 90.6 bits, see alignment E=1.8e-29 PF00672: HAMP" amino acids 294 to 345 (52 residues), 33.8 bits, see alignment 5.1e-12 PF00015: MCPsignal" amino acids 410 to 592 (183 residues), 141.9 bits, see alignment E=2.9e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1539)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW84 at UniProt or InterPro

Protein Sequence (626 amino acids)

>Psyr_1539 Histidine kinase, HAMP region:Bacterial chemotaxis sensory transducer (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTVRAKLLVGFGLLILMILLMAYTGKDATDTLKRRAELSGDIAQFSSIARDMRIERLVYF
LKADDAQASKWLEALERTERQLVSISPRFKTANNIALLKEAQTTMQLYRGFYTRSVEATR
EREQLRTLAGASGETINGLLLKIAEAANDESGNAADRQKLPALFISVQKMRTAFRSYTAS
PSKSGEDTVRQAIAQVVASIDTLKDTSLPRADVQALAAGMATYSGQLETLVAAQAKVDEA
QGGITTSIATILGITDKMTAIQNEFRASDAEKAQEKILLWLGLSALLGVLAAWLITRSIV
HPLKETVEIVEVVAEGDFTYKTQVTRNDELGALQGSMLRMTSGLRSLIGEMKDGIVQVAS
AAEQLSAVTEQTSAGVNAQKLETEQIATAMQQMTATTHEVSRNAAQAVNTAQIASQLAQK
GGQVVDRTRSQIETLAREMNMTRTAMAALRGNTQSIGGVLDVIKTVADQTNLLALNAAIE
AARAGEAGRGFAVVADEVRGLAVRTRTSTDEIALLINELQTSTDHMGQVLEQNLALTDSS
VELSTQASEVLQSITASVHEIEVMNEQIAVATEQQSNVGEEIGRGVTNVRDISDQTAAAS
EETATSSVELARVSARLQEMTNRFKV