Protein Info for Psyr_1477 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: conserved domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF10282: Lactonase" amino acids 194 to 295 (102 residues), 32.3 bits, see alignment E=1.9e-11 TIGR02276: 40-residue YVTN family beta-propeller repeat" amino acids 215 to 254 (40 residues), 38.5 bits, see alignment 4.3e-14 amino acids 256 to 296 (41 residues), 53 bits, see alignment 1.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1477)

Predicted SEED Role

"Surface antigen"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWE5 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psyr_1477 conserved domain protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNVIKKTVTALTLGVALAASMSAWAAQDRWTFDGDIHNNSLAVSPDETTAVVSYSQRPDV
VVYDLKTGKVRQVLTGYVTPRNIVFSPTGDVFYLSDSSLGVVRKIDTKTLKVIADIPLGA
GAFGTTLSKDGSLLYVNNEAASTLSVIDLDHQRPVAVVPGFSQPRQGIRVSPDGKTVYVT
NFLGDKITLVDSKTNTIEGEITGFNKLRAISISADGNTLYAANSGSNSIAVVDTQKRAIT
TTVIVGKDPYGAALTPDGLHVYSGNLGDNSLSVIDTKTLKVTTTVTGLKAPRQAIVFTKD
KSKAYVLNEDLSISTVDLASNKVVSTLKAD