Protein Info for Psyr_1378 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 TIGR02012: protein RecA" amino acids 4 to 324 (321 residues), 559.8 bits, see alignment E=9.8e-173 PF00154: RecA" amino acids 7 to 267 (261 residues), 479 bits, see alignment E=7.8e-148 PF08423: Rad51" amino acids 33 to 227 (195 residues), 35.9 bits, see alignment E=1e-12 PF06745: ATPase" amino acids 40 to 113 (74 residues), 26.6 bits, see alignment E=7.4e-10 PF21096: RecA_C" amino acids 271 to 326 (56 residues), 84.1 bits, see alignment E=1.2e-27

Best Hits

Swiss-Prot: 100% identical to RECA_PSEU2: Protein RecA (recA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to psb:Psyr_1378)

MetaCyc: 74% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWP3 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Psyr_1378 RecA protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDDNKKKALAAALGQIERQFGKGAVMRMGDHDRQAIPAISTGSLGLDIALGIGGLPKGRI
VEIYGPESSGKTTLTLSVIAQAQKMGATCAFVDAEHALDPEYAGKLGVNVDDLLVSQPDT
GEQALEITDMLVRSNAIDVIVVDSVAALVPKAEIEGEMGDMHVGLQARLMSQALRKITGN
IKNANCLVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRTGAVKEGDEVVGSE
TRVKVVKNKVAPPFRQAEFQILYGKGIYLNGEIVDLAVLHGFVEKSGAWYSYQGSKIGQG
KANSAKFLADNPEICKALEKQIRDKLLTPGVDTKAVGSREAVAADDMSEADVDI