Protein Info for Psyr_1372 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein-L-isoaspartate(D-aspartate) O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 16 to 221 (206 residues), 234.2 bits, see alignment E=7.4e-74 PF01135: PCMT" amino acids 21 to 221 (201 residues), 220.5 bits, see alignment E=1.1e-69

Best Hits

Swiss-Prot: 100% identical to PIMT_PSEU2: Protein-L-isoaspartate O-methyltransferase (pcm) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to psb:Psyr_1372)

MetaCyc: 53% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWP9 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Psyr_1372 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSREQDDLLRRGIGMTSQRTRERLIQRLCEEGISNQRVLDVIRKTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPYMVARMSELLLAAGPLDKVMEIGTGSGYQTAVLAQLVERVFSVE
RIKGLQDRAKERLVELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRLVIPVGSGEVQQLMLIIREENGFSRHVLGAVRFVPLLNGPIA