Protein Info for Psyr_1307 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Response regulator receiver:CheW-like protein:ATP-binding region, ATPase-like:Hpt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 789 PF01627: Hpt" amino acids 11 to 95 (85 residues), 45.5 bits, see alignment E=1.4e-15 PF02518: HATPase_c" amino acids 368 to 506 (139 residues), 47.4 bits, see alignment E=4.9e-16 PF01584: CheW" amino acids 513 to 641 (129 residues), 69.7 bits, see alignment E=4e-23 PF00072: Response_reg" amino acids 668 to 780 (113 residues), 87 bits, see alignment E=2e-28

Best Hits

KEGG orthology group: K13490, two-component system, chemotaxis family, sensor histidine kinase and response regulator WspE (inferred from 100% identity to psb:Psyr_1307)

Predicted SEED Role

"Sensor histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWW4 at UniProt or InterPro

Protein Sequence (789 amino acids)

>Psyr_1307 Response regulator receiver:CheW-like protein:ATP-binding region, ATPase-like:Hpt (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTPDQMRDASLFELFTLEADAQTQVLSAGLLALERNPTQADQLEACMRAAHSLKGAARIV
GVDFGVSVAHVMEDCLVSAQEGRLLLQAEHIDALLSGTDLLMRIATPGGDSVGQPDIDSY
VERLNTLLASGAGAARTVSTPLPDPASDALLASAMLQFETPSAAVVPESVPEPLAADLPA
SANPAAMPAAEPEAPFTPLRERRVAEGGERVLRVTAERLNGLLDMSSKSLVETQRLKPLL
AGMQRLKRLQSSSDRALEVLGASFGEEGPSADVQKALEDARSLLSQAQQVLVRHTAELDE
FGWQSAQRAQLLYDTALACRMRPFADVLNGQARMVRDLGRELGKQVRLQIEGEKTQVDRD
VLEKLDAPLTHLLRNAVDHGIESPEKRVASGKDPEGLIRLQASHQAGLLVVELSDDGGGV
DLERVRQSIVDRKLSPAETAAQLSEEELLSFLFLPGFSMRDKVTQISGRGVGLDAVQHMV
RQMHGSVELQQWAGEGSRFRIEMPLTLSVVRSLVVEVGGEAYAFPLAHIERMRDLQPDDI
LQLEGRQHFWDEERHVGLVSASQLLNRPPAQKAGETLKVVVIRERDAVYGVAVERFIGER
TLVVMPLDARLGKVQDVSAGALLDDGSVVLIIDVEDMLRSVEKLLNTGRLERIDRRARQA
DQVSRKRVLVVDDSLTVRELERKLLVSRGYEVSVAVDGMDGWNALRAEDFDLLITDIDMP
RMDGIELVTLLRRDTRLQSLPVMVVSYKDREEDRRRGLDAGADYYLAKASFHDDALLDAV
VELIGDAQG