Protein Info for Psyr_1300 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: PAS/PAC sensor hybrid histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 695 TIGR00229: PAS domain S-box protein" amino acids 194 to 284 (91 residues), 43.1 bits, see alignment E=2.2e-15 PF00989: PAS" amino acids 197 to 254 (58 residues), 29.9 bits, see alignment 1.9e-10 PF08448: PAS_4" amino acids 199 to 284 (86 residues), 24.4 bits, see alignment E=1.1e-08 PF13188: PAS_8" amino acids 200 to 248 (49 residues), 21.6 bits, see alignment 6.2e-08 PF13426: PAS_9" amino acids 202 to 284 (83 residues), 24.6 bits, see alignment E=1e-08 PF08447: PAS_3" amino acids 215 to 284 (70 residues), 39.2 bits, see alignment E=2.7e-13 PF00512: HisKA" amino acids 323 to 387 (65 residues), 31.6 bits, see alignment E=5.6e-11 PF02518: HATPase_c" amino acids 431 to 551 (121 residues), 58.6 bits, see alignment E=3.2e-19 PF00072: Response_reg" amino acids 577 to 688 (112 residues), 69.6 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1300)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWX1 at UniProt or InterPro

Protein Sequence (695 amino acids)

>Psyr_1300 PAS/PAC sensor hybrid histidine kinase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MISPTGFPTANGKAAGIIRSRDWSQTSLGPIEHWPVSLKNTLNLILNSPESMYLLWGPDL
VFFHNDAYTPILGPRKDNAIGALIPDLWADVWDQVAPLVIDAFAGKPCRYTDMPLTMARY
GEVEQTWWSFSFSPVIDEYGVVVGMFCITNETTAHVLNQQALQDSERKRLKLIDDLVSLE
RQQTARLEQRTLELDTFWEISPDPLAILDFNGIFLRVNPAWTALLGHPEHELLGTSIMTL
LHPDDVSGTQNALKHTINHVLPLFENRYQHVDGSYHWFGWTAAPGNGIIFALGKHLTHEK
DRIKALRIAEEALIQSQKMEAVGQLTGGLAHDFNNLLMGVTGNMELLLSRIRQERFTELD
RYINAALEGSRRAASLTHRLLAFSRRQTLAPKATDIDLLVVDMDELIRRTVGPAIDMQVN
ASRGLWATLVDPHQLENSLLNLCINAKDAMPDGGKLLIQTGNRHLTAVTATRYQLPAGRY
VELSVSDSGTGMSNDVMARAFDPFFTTKPTGMGTGLGLSMIYGFARQSGGGVYITSKVGE
GSKVSILLPMHEGEAETVAFDDSPLQVPASSTGDETILVVDDEPAVRLLITELLEDLGYI
VLQAERGADALTILQSKAAIDLLITDVGLPGGMNGRQVADAARDVRPDLKILFVTGYAEN
AALAHDTLEPGMHVLPKPFAIAELIGRVTELLEGE