Protein Info for Psyr_1279 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: CBS:Transporter-associated region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 57 to 81 (25 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details PF01595: CNNM" amino acids 15 to 149 (135 residues), 62.8 bits, see alignment E=4.9e-21 PF00571: CBS" amino acids 201 to 252 (52 residues), 20.4 bits, see alignment 8.2e-08 amino acids 268 to 316 (49 residues), 30.7 bits, see alignment 4.8e-11 PF03471: CorC_HlyC" amino acids 332 to 404 (73 residues), 62.9 bits, see alignment E=3.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1279)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWZ2 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Psyr_1279 CBS:Transporter-associated region (Pseudomonas syringae pv. syringae B728a ΔmexB)
MDNLPLGPLLGVLALLLLWAGLLTAVEAAHHQVKAMRSASRPEKSAPLPELAFNLNSLIL
GNTLIRVLISVIATLIAANYWLYNGPTVAWLATVSIMLVFAEYMPRRLANRHPVSTLLLG
NGVLRIPMKIIWPLAYVFNVLAKTLLRPFLSRAVQQQDQDFEDDTQNTPRNDAAQEYSPR
ASVLSGIRALDSITVNDILIPRNEVDGVNLDDPMEMIIERLIISRHTRLPVYHNDINQVQ
GVINTRDISHLLPKGTLTKEQLLAVCYEPYFVPESTPLQLQLLNFHKQQRRLGVVVDEYG
EVLGIVTLEDILEEIVGEFESEQRLDNPHVKQQDDGRLEVEGAASIRDLNKSLGWHLPSD
GPKTVNGLVTEALETIPDAPVCLKIGPYRLEILETEDNRVKRVAMWQNTLVRTFK