Protein Info for Psyr_1268 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: extracellular solute-binding protein, family 3:SLT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00497: SBP_bac_3" amino acids 43 to 266 (224 residues), 65.4 bits, see alignment E=4.5e-22 PF01464: SLT" amino acids 293 to 401 (109 residues), 80.2 bits, see alignment E=8.9e-27

Best Hits

Swiss-Prot: 100% identical to MLTF_PSEU2: Membrane-bound lytic murein transglycosylase F (mltF) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1268)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX03 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Psyr_1268 extracellular solute-binding protein, family 3:SLT (Pseudomonas syringae pv. syringae B728a ΔmexB)
MFFKPDFRPRCAKWLIATGLFLMLGACVEKPTTLERVKEDGVLRVITRNSPATYFQDRNG
ETGFEYELVKRFADDLGVELKIETADNLDDLFDQMNKPGGPVLGAAGLIETPLRKQQARF
SHSYLEVTPQVVYRNGQSRPTDPGDLVGKRIVVLKGSAHAEQLAALKAQNPGIQYEESDA
VEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGEARAQRWAVAPGEDNSLL
NEINAYLDKVEKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQERLPKYEKHFQTSAKKE
QVDWRLLAAIGYQESMWQPTVTSKTGVRGLMMLTQNTAQAMGVSNRLDARQSIQGGAKYF
AYIKDQLDDSIKEPDRTWLALASYNIGSGHLEDARKLAQNEGLNPDKWLDVKKMLPRLAQ
KKWYSKTRYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGSQVADGNLHVPGVDKTQPP
VPPASPVPSSSSTDESPL