Protein Info for Psyr_1206 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: type III secretion protein HrcT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 6 to 257 (252 residues), 284.5 bits, see alignment E=3.9e-89 PF01311: Bac_export_1" amino acids 15 to 245 (231 residues), 146.9 bits, see alignment E=3.6e-47

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to psb:Psyr_1206)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX62 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Psyr_1206 type III secretion protein HrcT (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPFDAHSAFQFMLGMGLAMARLMPCMLLVPAFCFKYLKGPLRYAVVAVMAMIPAPAISKA
LESLDDNWFAIGGLLIKEAVLGTLLGLLLYAPFWMFASVGALLDSQRGALSGGQLNPALG
PDATPLGELFQETLIMLVILTGGLSLMTQIIWDSYSVWPPTAWMPGMNAGGLDVFLEQLN
QTMQHMLLYAAPFIALLLLIEAAFAIIGLYAQQLNVSILAMPAKSMAGLAFLLIYLPTLL
ELGTGQLLKLVDLKSLLTLLVQVP