Protein Info for Psyr_1191 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: type III transcriptional regulator HrpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF00158: Sigma54_activat" amino acids 23 to 174 (152 residues), 197.2 bits, see alignment E=4.1e-62 PF14532: Sigma54_activ_2" amino acids 24 to 179 (156 residues), 57.7 bits, see alignment E=4.1e-19 PF07728: AAA_5" amino acids 32 to 132 (101 residues), 35.1 bits, see alignment E=3.2e-12 PF00004: AAA" amino acids 33 to 167 (135 residues), 22.7 bits, see alignment E=3e-08 PF02954: HTH_8" amino acids 260 to 300 (41 residues), 44.9 bits, see alignment 1.9e-15

Best Hits

Swiss-Prot: 97% identical to HRPS_PSESY: Pathogenicity locus probable regulatory protein HrpS (hrpS) from Pseudomonas syringae pv. syringae

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1191)

Predicted SEED Role

"type III transcriptional regulator HrpS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX77 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Psyr_1191 type III transcriptional regulator HrpS (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNLDDEFDDHLDAERVPNLGIVAESISQLGIDVLLSGETGTGKDTIARRIHNMSGRQGRF
VPMNCAAIPESLAESELFGVVSGAYTGADRSRMGYIEAAQGGTLYLDEIDSMPLALQAKL
LRVLETRALERLGSTSTINLDICVIASAQACLDDAVEEGKFRRDLYFRLNVLTLKLPPLR
DQPERILPLFTRFVAASAKELSVPIPDVCPLLQQVLTGHHWPGNIRELKAAAKRHVLGFP
LLGADSQTEEHLACGLKFQLRAIEKALIQQALKRHRNCIDAASLELDIPRRTLYRRIKEL
SI