Protein Info for Psyr_1157 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: diguanylate cyclase with PAS/PAC sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR00229: PAS domain S-box protein" amino acids 6 to 134 (129 residues), 66.2 bits, see alignment E=3.2e-22 amino acids 134 to 257 (124 residues), 77.1 bits, see alignment E=1.3e-25 PF13188: PAS_8" amino acids 10 to 69 (60 residues), 29.2 bits, see alignment E=2e-10 amino acids 137 to 180 (44 residues), 30.5 bits, see alignment 7.6e-11 PF00989: PAS" amino acids 11 to 120 (110 residues), 41.7 bits, see alignment E=3.2e-14 amino acids 139 to 247 (109 residues), 55.1 bits, see alignment E=2.2e-18 PF13426: PAS_9" amino acids 33 to 126 (94 residues), 64.6 bits, see alignment E=2.7e-21 amino acids 147 to 248 (102 residues), 63.1 bits, see alignment E=7.8e-21 PF08448: PAS_4" amino acids 36 to 116 (81 residues), 33.1 bits, see alignment E=1.7e-11 amino acids 144 to 250 (107 residues), 44.6 bits, see alignment E=4.6e-15 PF08447: PAS_3" amino acids 36 to 121 (86 residues), 42.3 bits, see alignment E=2.3e-14 amino acids 158 to 243 (86 residues), 38.9 bits, see alignment E=2.6e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 260 to 417 (158 residues), 166.1 bits, see alignment E=5.6e-53 PF00990: GGDEF" amino acids 261 to 414 (154 residues), 161.7 bits, see alignment E=4e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1157)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXB1 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Psyr_1157 diguanylate cyclase with PAS/PAC sensor (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTSSSQRLALLEAVVEQSFNAVLITDANLANGGPFIVYVNPAFCAMTGYTAEALIGASPR
ILQGPDTDPQVIERMRECLSESLFFEGSTVNYRADGSPYIVEWKISPVRDDAGTVCNFVS
VQQNISPRIRAEREQHLLAQALNAALDPIIITDCNSTIVFANEAFQQITGYSSSEILGEN
PRMLSSGKHDEAFYAQFKEALKSGAPLRTTFINKRKDGSLFYAEHSISPLCNLEGAITHY
VSISQDVTTRLGREQKLLEIAHSDPLTGLDNRRSAEHTLERQIPAVSMSGKPFSLIICDI
DHFKAVNDRYGHPAGDSVITSVAAILKQRIRLLDVAARWGGEEFLILVPDSSLKQAAELA
ERIRNSVESLVIPETGSVTISLGVAELSAGETAASLIQRADKALYQAKRLGRNRVECA