Protein Info for Psyr_1122 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: 2-keto-3-deoxy-phosphogluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF01081: Aldolase" amino acids 20 to 213 (194 residues), 275.6 bits, see alignment E=9.7e-87 TIGR01182: 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase" amino acids 21 to 221 (201 residues), 252.4 bits, see alignment E=1.2e-79

Best Hits

Swiss-Prot: 70% identical to ALKD_PSEPU: 2-dehydro-3-deoxy-phosphogluconate aldolase (eda) from Pseudomonas putida

KEGG orthology group: K01625, 2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC: 4.1.2.14 4.1.3.16] (inferred from 100% identity to psb:Psyr_1122)

MetaCyc: 43% identical to 2-dehydro-3-deoxy-D-gluconate-6-phosphate aldolase (Dickeya dadantii 3937)
2-dehydro-3-deoxy-phosphogluconate aldolase. [EC: 4.1.2.14, 4.1.2.55]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.14 or 4.1.2.55 or 4.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXE6 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Psyr_1122 2-keto-3-deoxy-phosphogluconate aldolase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTQNENNQPLTSMANKIAQIDELCAKAKILPVITIARDQDVLPLADALAAGGMTALEVTL
RSAFGLSAIRILREQRPELCVGAGTILDRKMLADAEAAGSQFIVTPGSTQELLQAALDSP
LPLLPGISSASEIMIGYAMGYRRFKLFPAEISGGVAAIKALGGPFNEVRFCPTGGVNEQN
LKSYMALPNVMCVGGTWMIDNAWVKNGDWGRIQEATAQAMALFD