Protein Info for Psyr_1101 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Helix-turn-helix, Fis-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF14532: Sigma54_activ_2" amino acids 194 to 365 (172 residues), 70 bits, see alignment E=5.2e-23 PF00158: Sigma54_activat" amino acids 194 to 360 (167 residues), 223.3 bits, see alignment E=3.2e-70 PF07728: AAA_5" amino acids 216 to 327 (112 residues), 22.3 bits, see alignment E=2.3e-08 TIGR04381: TyrR family helix-turn-helix domain" amino acids 452 to 498 (47 residues), 82.6 bits, see alignment 7.5e-28 PF18024: HTH_50" amino acids 452 to 498 (47 residues), 53.6 bits, see alignment 2.9e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1101)

Predicted SEED Role

"transcriptional regulator, MerR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXG7 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Psyr_1101 Helix-turn-helix, Fis-type (Pseudomonas syringae pv. syringae B728a ΔmexB)
MRIHVSFIDRVGITQEVLAILGGRNLNLDAVEMVPPNVYIDAPTLSHQMLEELKDALFRV
RGVEAITVVDILPGQRRHLQLDALLAAMTDPVLALDSAGHVLLANPALIALIGREPAGES
IGELFSDPSLHVALLENGFRLPLREITLNGEALLLDATPITEAGALITLYLPSRIGERLS
ALHHDHAEGFDALLGDSAAIRTLKARAQRVAALDAPLLIQGETGTGKELVARACHASSAR
HGEPFLALNCAALPENLAESELFGYAPGAFTGAQRGGKPGLMELANQGSVFLDEIGEMSP
YLQAKLLRFLNDGSFRRVGGDREVRVNVRILSATHRDLEKMVSEGTFREDLFYRLNVLNL
EVPPLRERGQDILLLARYFMEQACAQIQRPVCRLAPGTYPALLGNRWPGNVRQLQNVIFR
AAAICEHTQVDIGDLDIAGTAVARQNDSPIDSLENAVEAFERNLLEKLYADYPSTRQLAN
RLHTSHTAIAHRLRKYGIPGKR