Protein Info for Psyr_1097 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 2 to 123 (122 residues), 129.9 bits, E=2.9e-42
• PF01597: GCV_H
  • amino acids 4 to 122 (119 residues), 115.4 bits, E=7.8e-38

Best Hits

Swiss-Prot: 91% identical to GCSH1_PSESM: Glycine cleavage system H protein 1 (gcvH1) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 100% identity to psb:Psyr_1097)

MetaCyc: 43% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See Q4ZXH1 at UniProt or InterPro

Protein Sequence (127 amino acids)

>Psyr_1097 glycine cleavage system H protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSDLRFTVDHEWLRAETDGSVTVGITPYAQESLGDVVFVQLPELQAYTQHAEVSVVESVK
AASSINMPLDGDVVEVNSALDATPELVNEDALGAGWFFRFVPQDANAIHGLLDQDAYDRL
IKANAEA