Protein Info for Psyr_1056 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Poly(beta-D-mannuronate) lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF05426: Alginate_lyase" amino acids 65 to 305 (241 residues), 225.3 bits, see alignment E=5.2e-71

Best Hits

Swiss-Prot: 100% identical to ALGL_PSEU2: Alginate lyase (algL) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01729, poly(beta-D-mannuronate) lyase [EC: 4.2.2.3] (inferred from 100% identity to psb:Psyr_1056)

Predicted SEED Role

"Alginate lyase precursor (EC 4.2.2.3)" in subsystem Alginate metabolism (EC 4.2.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXL0 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Psyr_1056 Poly(beta-D-mannuronate) lyase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MQTPKLIRPTLLSMAILSSMAWATGASAALVPPKGYDAPIEKIKTGDHSFSCEAIPKPYT
DKLVFRSKYEGSDKARATLNAVSEEAFRDATKDITTLERGVSKVVMQYMRDGRPEQLDCA
LNMMTTWAKADALESREFNHTGKSMRKWALGSMSSAYLRLKFSESHPLANRQQDAKIIEA
WFSKLADQVVSDWSNLPLDKINNHSYWAAWSVMATAVATNRQDLFDWAVKEYKVAANQVD
KDGFLPNEMKRRQRALSYHNYALPPLAMIASFAQANGVDLRPENNGALKRLGDRVLAGVK
DPSIFAEHNGEKQDMTDLKKDPKFAWLEPYCSLYTCSPDVLEEKHEKQPFKTFRLGGDLT
KVYDPSHEKGDKGDNDGS