Protein Info for Psyr_1055 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Membrane bound O-acyl transferase, MBOAT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 66 (38 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 490 to 515 (26 residues), see Phobius details PF03062: MBOAT" amino acids 150 to 373 (224 residues), 107.2 bits, see alignment E=5.4e-35

Best Hits

Swiss-Prot: 97% identical to ALGI_PSESM: Probable alginate O-acetylase AlgI (algI) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1055)

MetaCyc: 81% identical to alginate acetyl donor transporter AlgI (Pseudomonas aeruginosa)
TRANS-RXN-271

Predicted SEED Role

"Probable poly(beta-D-mannuronate) O-acetylase (EC 2.3.1.-)" in subsystem Alginate metabolism (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXL1 at UniProt or InterPro

Protein Sequence (518 amino acids)

>Psyr_1055 Membrane bound O-acyl transferase, MBOAT (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVFSSNVFLFLFMPIFLGLYYLSGQRYRNLLLLIASYIFYAWWRVDFLALFIGVTVWNYW
IGLKVGAAGVRTKPAQKWLLLGVIVDLCILGYFKYANFGVDSINAAMTSMGLEPFILTHV
LLPIGISFYVFESISYIIDVYRGDTPATRNLIDFAAFVAIFPHLIAGPVLRFRDLADQFN
NRTHTLDKFSEGATRFMQGFIKKVFIADTLAVVADHCFALQNPTTGDAWLGALAYTAQLY
FDFSGYSDMAIGLGLMMGFRFMENFKQPYISQSITEFWRRWHISLSTWLRDYLYITLGGN
RGGKVATYRNLFLTMLLGGLWHGANVTYIIWGAWHGMWLAIEKAVGINTKPYSFNVIRWA
LTFLLVIIGWVIFRAENLHVAGRMYSAMFSFGEWQLSELNRASLTGLQVATLVVAYLTLA
FFGLRDFYQNREKDTGKSTKADGPATAQPGTIKAVPGDAPGSLHMPGYTVGSEAQVQPAY
WEADWPRYAMRALILLLFVASILKLSAQSFSPFLYFQF