Protein Info for Psyr_1030 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: bacteriophage N4 adsorption protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 706 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 363 to 384 (22 residues), see Phobius details amino acids 404 to 421 (18 residues), see Phobius details amino acids 443 to 461 (19 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 72 to 334 (263 residues), 115.4 bits, see alignment E=6.5e-37 PF13632: Glyco_trans_2_3" amino acids 168 to 384 (217 residues), 135 bits, see alignment E=4.5e-43 PF05157: MshEN" amino acids 548 to 628 (81 residues), 38.2 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K11740, bacteriophage N4 adsorption protein B (inferred from 100% identity to psb:Psyr_1030)

Predicted SEED Role

"Bacteriophage N4 adsorption protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXN6 at UniProt or InterPro

Protein Sequence (706 amino acids)

>Psyr_1030 bacteriophage N4 adsorption protein B (Pseudomonas syringae pv. syringae B728a ΔmexB)
MTSLYWPYWLAHYYSVLEVATIVVGLIILVSSIDDLFIDIWYWSRRLYRKFTAERRYRPL
TAEQLTARDEQPLAIMVPAWLEYDVIAPMIENMVSTLDYQNYVVFVGTYINDQRTIDEVE
RMRRRYKQLHRVEVPHAGPTCKADCLNWVIQAIFLYEKTHAVQFAGTILHDSEDVLHPLE
LRLFNYLLPRKDMIQLPVVSLERNWYEWVAGTYMDEFAEWHGKDLVVRESMTDTVPSAGV
GTCFSRRALMVLADENQNQPFNTESLTEDYDVGARLAKYGMQAIFVRFPVQFRVLRKSWF
RKPYESTLEMPLCVREFFPDTFRTAFRQKARWTLGIGLQGWEQMGWTGSLANRYLLFRDR
KGVVTSFISIIAYLILIQLLALIVLRSSGLWNTSFPTPFETTGLIQYLLVANGIALLWRI
LHRCYFTTVLYGWQHGLLSIPRMVVGNFVNFMAAARAWRMFLVGKVLNRKLVWDKTMHDF
PSSDLIAVAPRRLGSVLLSWQAINDEKLQTALTEQQTRQVPLGRILLSHGWLDDETLAEA
IAFQNDLPRVFDIASKRADNSVLADEFCLRWRVVPLQMNALGRQEIAVASPLPPDGLQQI
SEQLGAEPVQLIARESDIVAQLRQLQVVEGQPLPARAPLLGDLLIEQGLLDREVFQKAML
GYRPHVHGRIGDYLVDIGVLPRETIEQAVARQHNHYRSDDQTEQPL