Protein Info for Psyr_1015 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Protein of unknown function DUF540

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 67 to 96 (30 residues), see Phobius details amino acids 148 to 174 (27 residues), see Phobius details amino acids 210 to 237 (28 residues), see Phobius details PF07264: EI24" amino acids 11 to 227 (217 residues), 170.4 bits, see alignment E=2.6e-54

Best Hits

Swiss-Prot: 98% identical to CYSZ_PSESM: Sulfate transporter CysZ (cysZ) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K06203, CysZ protein (inferred from 100% identity to psb:Psyr_1015)

MetaCyc: 44% identical to sulfate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-586

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZXQ1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psyr_1015 Protein of unknown function DUF540 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPAPALTGPQYLREGLKLVLSPGLRLFVLLPLSINVVLFCGLIYLAVHQFELWVDTFMPT
LPHWLSFLSYILWPLFVALVLLMVFFTFTVVANIIAAPFNGFLSEKVEAVVRGVDESPDF
SWAELVAMVPRTLAREARKLGYMLPRMLGLFILSFIPVANIIAAPLWLLFGVWMMAIQYI
DYPADNHKLGWNEMLGWLKSKRWQSLSFGGIVYVALLIPVVNLLMMPAAVAGATLFWVRE
RGADALPVTHARG