Protein Info for Psyr_0975 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: homocysteine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02574: S-methyl_trans
  • amino acids 19 to 308 (290 residues), 199.3 bits, E=6.3e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0975)

Predicted SEED Role

"Homocysteine S-methyltransferase (EC 2.1.1.10)" in subsystem Methionine Biosynthesis (EC 2.1.1.10)

MetaCyc Pathways

• L-methionine salvage from L-homocysteine (2/3 steps found)
• S-methyl-L-methionine cycle (1/2 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.10

Sequence Analysis Tools

See Q4ZXU1 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Psyr_0975 homocysteine S-methyltransferase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSFFHIHISRSHMTQGTTVILDGGMGRELQRRGAPFRQPEWSALALSEAPEAVSAVHAAY
IESGAQVITSNSYAVVPFHIGEERFAREGQALAALAGQLARESADASGGRARVAGSIPPL
FGSYRPDLYKPEQATDVLKPLVAGLSPYVDLWLAETQSCILEAQTIRAGLPNDGKPFWLS
FTLQDEDTDEVPRLRSGEPVADAARAAAAMGVATLLFNCSQPEVIGGAIDAAREVFTSLN
VDIAIGAYANAFPPQPKDATANDGLDELREDLDPQGYQQWAADWVKRGATHIGGCCGIGP
EHIAVLSRSL