Protein Info for Psyr_0918 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 40 to 172 (133 residues), 84.8 bits, E=9.3e-28
• PF14524: Wzt_C
  • amino acids 258 to 397 (140 residues), 125 bits, E=2.3e-40

Best Hits

KEGG orthology group: K09691, lipopolysaccharide transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_0918)

MetaCyc: 59% identical to O:8-antigen ABC transporter ATP-binding subunit (Escherichia coli O8)
TRANS-RXN-445 [EC: 7.5.2.14]

Predicted SEED Role

No annotation

MetaCyc Pathways

• Escherichia coli serotype O:8 O antigen biosynthesis (2/9 steps found)
• Escherichia coli serotype O:9a O antigen biosynthesis (1/10 steps found)
• H. pylori 26695 O-antigen biosynthesis (1/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.14

Sequence Analysis Tools

See Q4ZXZ6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Psyr_0918 ABC transporter (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSLLSVSNLGKAYRVYASEFQRIARWFGIPTKPSEEHWVLKHISFSIEPGEAIGIVGQNG
AGKSTLLKMITGTLQPTEGHVQVNGRIAAILELGMGFTPDLTGRQNVYHAAGLMGFSAEQ
INGVIDEVEAFAEIGDYFDEPVRMYSSGMQMRVAFAVATAIRPEILIVDEALSVGDSYFQ
HKSFERIRQFQAQGTTLLIVSHDRGSIQALCSRAILLEKGTVIKDGKPEEVMDFYNALIA
EKENATVQVRELEDGSMQTRSGSGEATIGSVSLHNAAGERIEYVSVGEPVSLRINAQVNS
AIPELVVGYLIKDRLGQPVYGTNTHHMDCKVIDLQGGESLDYSFNFPANLGVGSYSVAVA
LHTTDSHLSRNYEWVDLTVVFNVVNISQSEFVGLAWLPPVVECSR