Protein Info for Psyr_0902 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 PF04321: RmlD_sub_bind" amino acids 13 to 162 (150 residues), 29.9 bits, see alignment E=1.1e-10 PF02719: Polysacc_synt_2" amino acids 15 to 122 (108 residues), 20.7 bits, see alignment E=7.2e-08 PF01370: Epimerase" amino acids 15 to 186 (172 residues), 78.6 bits, see alignment E=1.7e-25 PF01073: 3Beta_HSD" amino acids 16 to 155 (140 residues), 47.4 bits, see alignment E=4.7e-16 PF13460: NAD_binding_10" amino acids 18 to 123 (106 residues), 34.6 bits, see alignment E=6.4e-12 PF16363: GDP_Man_Dehyd" amino acids 39 to 172 (134 residues), 55.2 bits, see alignment E=3e-18 PF07993: NAD_binding_4" amino acids 64 to 182 (119 residues), 31.6 bits, see alignment E=3.5e-11

Best Hits

Swiss-Prot: 92% identical to URODH_PSESM: Uronate dehydrogenase (udh) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0902)

MetaCyc: 92% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.203

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY12 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Psyr_0902 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MASAHTTQTPFNRLLLTGAAGGLGKVLRETLRPYANVLRLSDIAEMAPAVDDREEVQVCD
LANKDAVHQLVEGVDAIVHFGGVSVERPFEEILGANICGVFHIYEAARRHGVKRVIFASS
NHVIGFYKQTETIDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFAEPQ
NRRMMSTWLSFGDLTQLIERSLYTPDVGHTVVYGVSDNKTVWWDNRLASKLDYTPKDSSE
VFREKVDAQPLPAADDPAMLYQGGAFVASGPFGDQ