Protein Info for Psyr_0835 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: transcriptional regulator, TraR/DksA family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 TIGR02420: RNA polymerase-binding protein DksA" amino acids 27 to 135 (109 residues), 168.3 bits, see alignment E=3.2e-54 PF21157: DksA_N" amino acids 32 to 101 (70 residues), 114.8 bits, see alignment E=1.7e-37 PF01258: zf-dskA_traR" amino acids 105 to 137 (33 residues), 38 bits, see alignment 1.3e-13

Best Hits

Swiss-Prot: 73% identical to DKSA_ECOL6: RNA polymerase-binding transcription factor DksA (dksA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 100% identity to psb:Psyr_0835)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZY79 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Psyr_0835 transcriptional regulator, TraR/DksA family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPTPEKQQNHLISGFEPYVPTKGEEYMGEPMRAHFTKILNKWKQDLMQEVDRTVDHMKDE
AANFPDPADRASQEEEFSLELRARDRERKLIKKIDKTLQLIKDEEYGWCESCGVEIGIRR
LEARPTADQCVDCKTLAEIKEKQVGK