Protein Info for Psyr_0802 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Peptidase S1, chymotrypsin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 14 (14 residues), see Phobius details PF02342: TerD" amino acids 72 to 154 (83 residues), 30.9 bits, see alignment E=2.7e-11 PF00089: Trypsin" amino acids 183 to 335 (153 residues), 30.4 bits, see alignment E=5.4e-11 PF13365: Trypsin_2" amino acids 185 to 318 (134 residues), 91.9 bits, see alignment E=1e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0802)

Predicted SEED Role

"Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYB2 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Psyr_0802 Peptidase S1, chymotrypsin (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKLLAPGANTALANAHCPWNLESGKSSVFGEYAAVALLAVNDKRQPMGDPALLHQEQGWM
EWSGGPQDVGCTLRLDRLPTGSDRVLLMVYVYAAMGPIRDIGSLHLKVDSDIEHRLDLRD
NGEAAIIIGEFYQRNEQWKFRALSEGSAYGLSAFGRKIGLDVDDRHPRRPSGGSSGGPRH
ESATGTAFVVGPAHVMTCAHVIEDMGVFYITSLEGRYKAEPVVIDRRNDIALLRVQGAPP
LSPVTFRDGQGCEPGDTVAVLGYPLASISGGGLQVTQGGISGLFGLHNDASLFQFTAPIQ
PGSSGSPLFDNGGAVIGMVTSTVPDGQNMNFAVKSALLLAFLQACRIDAAHARPERSYTT
TEISRTAQSSLWLVEASRQ