Protein Info for Psyr_0799 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Fimbrial protein pilin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF07963: N_methyl" amino acids 1 to 26 (26 residues), 40 bits, see alignment 1.9e-14 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 27 (24 residues), 37.8 bits, see alignment 5.3e-14 PF00114: Pilin" amino acids 36 to 132 (97 residues), 29.6 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 40% identical to TAPA_AERHY: Pilus biogenesis protein TapA (tapA) from Aeromonas hydrophila

KEGG orthology group: K02650, type IV pilus assembly protein PilA (inferred from 100% identity to psb:Psyr_0799)

Predicted SEED Role

"Type IV pilin PilA" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYB5 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Psyr_0799 Fimbrial protein pilin (Pseudomonas syringae pv. syringae B728a ΔmexB)
MNAQKGFTLIELMIVVAIVGILAAVAIPQYRDYTMRARFSDVVSVASTYQTAVAVCIQTQ
GVANGCNLNTNGIPDTQATANVTSVAVNNGVITVVPTATTNVASTLVLTPVLGAGGITWN
KAGSGCLAAQAPAPILCTL