Protein Info for Psyr_0610 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: ABC-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details PF01061: ABC2_membrane" amino acids 18 to 219 (202 residues), 40.9 bits, see alignment E=8.5e-15

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 100% identity to psb:Psyr_0610)

Predicted SEED Role

"O-antigen export system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYU2 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Psyr_0610 ABC-2 (Pseudomonas syringae pv. syringae B728a ΔmexB)
MPSFCSPGVMKWRDLIINLVIKEIKIRYMGATLGFIWSLGNPLVVTLTYYTVFTYILPSS
QDRFALHLVTGIVHWMLLAQIVSQSGEWLINNGNLIRKLRFPRLLLPISGALAIVVFWAG
CMLVYSSLFAVLGGIFSRALLFYPIVLIAFMALIMGVGLALSVIQVTVRDAKHFIDVFLP
LLFWLTPIVWVSSSLPVGIANIAAYNPIGLYFNSFTSILHAGVVPEPRDLLLCVFMGAAS
LLVGLFMFRKVDSVVEYL