Protein Info for Psyr_0577 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Adenylosuccinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00184: adenylosuccinate synthase
  • amino acids 6 to 429 (424 residues), 610.1 bits, E=1e-187
• PF00709: Adenylsucc_synt
  • amino acids 6 to 423 (418 residues), 606.3 bits, E=1.3e-186

Best Hits

Swiss-Prot: 100% identical to PURA_PSEU2: Adenylosuccinate synthetase (purA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01939, adenylosuccinate synthase [EC: 6.3.4.4] (inferred from 99% identity to pst:PSPTO_4937)

MetaCyc: 70% identical to adenylosuccinate synthetase (Escherichia coli K-12 substr. MG1655)
Adenylosuccinate synthase. [EC: 6.3.4.4]

Predicted SEED Role

"Adenylosuccinate synthetase (EC 6.3.4.4)" in subsystem CBSS-262719.3.peg.410 or Purine conversions (EC 6.3.4.4)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine ribonucleotides de novo biosynthesis (3/3 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.4

Sequence Analysis Tools

See Q4ZYX5 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Psyr_0577 Adenylosuccinate synthetase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MGKNVVVLGTQWGDEGKGKIVDLLTEHATAVVRYQGGHNAGHTLVIDGEKTVLHLIPSGV
LREGVQCLIGNGVVVAPDALLREIVKLEEKGIPVRERLRISPSCPLILSYHVALDQAREK
ARGEFKIGTTGRGIGPAYEDKVARRGLRIGDLFHRERFAAKLGELLDYHNFVLVNYYKEP
AIDFQKTLDECMEYADMLKPLMLDVTAALHEMRRDGKDIMFEGAQGSLLDIDHGTYPYVT
SSNTTAGGIATGSGFGPMYLDYILGITKAYTTRVGSGPFPTELFDDVGAFLAKRGHEFGA
TTGRARRCGWFDAVILRRAIEINSISGLCLTKLDVLDGLETINICVGYENEEGAVIDAPT
DADSYLGLRPVYEQMPGWSESTLGAKTLEELPAAARAYIKRVEELVGAPIDIISTGPDRN
ETIVLRHPFG