Protein Info for Psyr_0574 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: protease FtsH subunit HflK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 70 to 93 (24 residues), see Phobius details PF12221: HflK_N" amino acids 1 to 49 (49 residues), 66.7 bits, see alignment 1.4e-22 TIGR01933: HflK protein" amino acids 90 to 351 (262 residues), 378.7 bits, see alignment E=7.2e-118 PF01145: Band_7" amino acids 92 to 263 (172 residues), 100.1 bits, see alignment E=1.5e-32

Best Hits

Swiss-Prot: 41% identical to HFLK_HAEIN: Protein HflK (hflK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04088, membrane protease subunit HflK [EC: 3.4.-.-] (inferred from 100% identity to psb:Psyr_0574)

Predicted SEED Role

"HflK protein" in subsystem Hfl operon

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZYX8 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Psyr_0574 protease FtsH subunit HflK (Pseudomonas syringae pv. syringae B728a ΔmexB)
MAWNEPGGNSNNQDPWGGKRRGGDRKGPPDLDEAFRKLQESLKGLFGGGNKRGSDGGSSG
SGGGSGKGGGFGLLGIGLVVLVAFWLYSAIYVVDEQEQAVVLRFGQYHETVGPGLNIYFP
PFDRKYMENVTRERAYSKQGQMLTEDENIVEVPLTVQYKISDLQAFVLNVDQPEISLQHA
TESALRHVVGSTAMDQVLTEGRELMASEIKERLQRFLDTYRTGITVTQVNVQSAAAPREV
QEAFDDVIRAREDEQRARNQAESYANGVIPEARGQAQRILEDANGYRDEVVSRAKGEADR
FTKLVAEYRKAPEVTRQRLYLDTMQEVFSNTSKVLVTGDKGQNNLLYLPLDKMIESSRSG
TGNGSNSGTPSQSANDAAAAAAARATEAQQRGEVRTRETR