Protein Info for Psyr_0523 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Lipopolysaccharide kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 79% identical to RFAP_PSEAE: Lipopolysaccharide core heptose(I) kinase RfaP (rfaP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02848, heptose (I) phosphotransferase [EC: 2.7.1.-] (inferred from 100% identity to psb:Psyr_0523)

MetaCyc: 55% identical to lipopolysaccharide core heptose (I) kinase (Escherichia coli K-12 substr. MG1655)
RXN-22461 [EC: 2.7.1.235]; 2.7.1.235 [EC: 2.7.1.235]

Predicted SEED Role

"Lipopolysaccharide core biosynthesis protein WaaP (EC 2.7.-.-), heptosyl-I-kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

superpathway of Kdo₂-lipid A biosynthesis (14/25 steps found)
lipid A-core biosynthesis (E. coli K-12) (2/10 steps found)
lipid A-core biosynthesis (Salmonella) (2/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-

Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.1.235

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ29 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Psyr_0523 Lipopolysaccharide kinase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKLFLAEPFKSLWAERDAFVEVEGLSGEVYRELEGRRTLRTEVDGRGYFVKIHRGIGWGE
IAKNLATAKLPVLGAGKEWDAIERLHEVGVPTMTAVAYGERGSNPAAQHSFIVTEELAPT
ISLEDISLNWRSEPPEPRLKRAFIAEVARMVGMMHRAGVNHRDCYICHFLLHTDKPVTAD
DFKLSVIDLHRAQTRRAITPRWRNKDLAALYFSALDIGLTRRDKLRFLKGYFQKPLREIL
LKEATLLTWLDKKADKLYQRKVRYGDAL