Protein Info for Psyr_0502 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: potassium/proton antiporter, CPA1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 106 to 131 (26 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 315 to 340 (26 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 380 to 399 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 34 to 405 (372 residues), 199.8 bits, see alignment E=9.6e-63 PF02080: TrkA_C" amino acids 434 to 500 (67 residues), 53.3 bits, see alignment E=3.1e-18 PF03471: CorC_HlyC" amino acids 513 to 586 (74 residues), 42.4 bits, see alignment E=8.4e-15

Best Hits

Swiss-Prot: 100% identical to NHAP2_PSEU2: K(+)/H(+) antiporter NhaP2 (nhaP2) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 99% identity to psp:PSPPH_0493)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZ50 at UniProt or InterPro

Protein Sequence (598 amino acids)

>Psyr_0502 potassium/proton antiporter, CPA1 family (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVSFRPSRCNSVFYGVPPLDATTINSLFLIGALLVAASILVSSLSSRLGIPILVIILAVG
MVAGVDGGGIIFDNYATAYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLIT
TVLTGMMAAWLFNLSVIQGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDP
MAVFLTVTLIGMLASGQTGLHWGLLGHLIQEFGIGSFIGLGGGWILLQLVNRINLAAGLY
PILVIAGGLAIFALTNAIHGSGFLAVYLCGLVLGNRPIRSRHGILHMLDGMAWLAQIGMF
LVLGLLVTPHDLLPIAIPALGLALWMILVARPLSVMVGLLPFKAFHDREKAFIAWVGLRG
AVPIILAVFPLMAGLPNAQLYFNLAFFIVLVSLLLQGTSLPWMAKLLKVTVPPDPAPISR
AALEVHVTSEWELFVYRLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGSTTLEV
GDLLCVIGHEHDLPALGKLFSQAPQRGLDLRFFGDFVLEGDARLGEVAALYGLKLDGIDP
GMPLSQFIVQKNRGEPVVGDQVEWNGTIWTVAVMDGNKIQKVGVKFPEGTRPGPGLFL