Protein Info for Psyr_0447 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: malonate decarboxylase subunit, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF20866: MdcG_N" amino acids 11 to 82 (72 residues), 63.5 bits, see alignment E=1.5e-21 TIGR03135: malonate decarboxylase holo-[acyl-carrier-protein] synthase" amino acids 11 to 204 (194 residues), 179.1 bits, see alignment E=5e-57 PF10620: MdcG" amino acids 90 to 205 (116 residues), 123.4 bits, see alignment E=5.2e-40

Best Hits

Swiss-Prot: 81% identical to MDCG_PSESM: Phosphoribosyl-dephospho-CoA transferase (mdcG) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K13934, phosphoribosyl-dephospho-CoA transferase [EC: 2.7.7.66] (inferred from 100% identity to psb:Psyr_0447)

Predicted SEED Role

"Phosphoribosyl-dephospho-CoA transferase (EC 2.7.7.-)" in subsystem Malonate decarboxylase (EC 2.7.7.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.66

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZA5 at UniProt or InterPro

Protein Sequence (213 amino acids)

>Psyr_0447 malonate decarboxylase subunit, putative (Pseudomonas syringae pv. syringae B728a ΔmexB)
MVISNTGAVLPHDLLWGMPLTALPDDAPKWAVEAVLAGQPVVVRRQAMPAGQQVAVGLRG
RGREQRYAASMPLAEVCRRVMPEQLIDAPTEIHQQWPALQALRQIRPVMEALELDWGVGG
SAGFELASGIAALHQDSDLDLILRTPGRLNRRCAAELVEALETSVCRVDVQLQLESGAVA
LREWARPTGRVLLKTATGARLVADPWHLGQVCA