Protein Info for Psyr_0407 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: type II and III secretion system protein:NolW-like protein:NolW-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details PF11741: AMIN" amino acids 57 to 138 (82 residues), 25.8 bits, see alignment E=1.8e-09 amino acids 184 to 284 (101 residues), 68.5 bits, see alignment E=9.3e-23 TIGR02515: type IV pilus secretin PilQ" amino acids 300 to 710 (411 residues), 543.7 bits, see alignment E=1.7e-167 PF07660: STN" amino acids 326 to 373 (48 residues), 34 bits, see alignment 4e-12 PF03958: Secretin_N" amino acids 399 to 465 (67 residues), 48.3 bits, see alignment E=1.9e-16 PF00263: Secretin" amino acids 553 to 709 (157 residues), 169.4 bits, see alignment E=1.1e-53

Best Hits

Swiss-Prot: 73% identical to PILQ_PSEAE: Fimbrial assembly protein PilQ (pilQ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 100% identity to psb:Psyr_0407)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZE5 at UniProt or InterPro

Protein Sequence (718 amino acids)

>Psyr_0407 type II and III secretion system protein:NolW-like protein:NolW-like protein (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKWARPSMHSSAQRKLIMTRILSIIGVSLCIAMLSPVLQAANLKTLDVAALPGDRIELKL
AFDAPVPAPRGYTTSQPARIALDLPGVTSQLATKSRDLGTGNARSVVVVQAQDRTRVIIN
LTTLSPYSSRVDGNNLFVVIGQGAGAAQASQPTTAMGAQRVAVPPPTPASAKPFIPAGVK
AIRNVDFQRGELGEGNVVIDLSNPSIAPDIQEQGGKIRVDFAKTQLPEPLRVRLDVKDFA
TPVQFVSASATGDKASILIEPSGAFDYSAFQTENKLTISVRPLTNEDLDRRAADKPVYTG
EKLSLNFQDIDVRSVLQLIADFTNLNLVASDTVQGGITLRLQNVPWDQALDLVLKTKGLD
KRKVGNVLLVAPADEIAARERQELESLKQIAELAPLRRELLQVNYAKAADIAKLFQSVTS
AESKADERGSITVDDRTNNIIAYQTQERLDELRRIVSQLDIPVRQVMIEARIVEANVDYN
KQLGVRWGGSTNTSGSGKWTTYGLDNNGDEAGNTSGNLTPNVPFVDLGAAGATSGIGLGF
VTNNTLLDLELSAMEKTGNGEIVSQPKVVTSDKETAKILKGTEIPYQESSSSGATTVSFK
EASLSLEVTPQITPDNRIIMEVKVTKDEPDYLNAVLGVPPIKKNEVNAKVLISDGETIVI
GGVFSNTQSKVVDKVPFLGDVPYLGRLFRRDVVSESKSELLVFLTPRIMNNQAISVSR