Protein Info for Psyr_0397 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: arginyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 PF03485: Arg_tRNA_synt_N" amino acids 4 to 90 (87 residues), 88.4 bits, see alignment E=6e-29 TIGR00456: arginine--tRNA ligase" amino acids 5 to 579 (575 residues), 568.5 bits, see alignment E=7e-175 PF00750: tRNA-synt_1d" amino acids 102 to 449 (348 residues), 430.1 bits, see alignment E=9.1e-133 PF05746: DALR_1" amino acids 463 to 579 (117 residues), 119.7 bits, see alignment E=1.1e-38

Best Hits

Swiss-Prot: 100% identical to SYR_PSEU2: Arginine--tRNA ligase (argS) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 100% identity to psb:Psyr_0397)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZF5 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Psyr_0397 arginyl-tRNA synthetase (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKDTIRQLIQQALTRLVTEGVLPEGLTPAIQVENARDKTHGDFASNIAMMLAKPAGMKPR
DLAEKLIAALPADQQISKVEIAGPGFLNFFQNTAALAARLDAALADPEKLSVRKAGAAQR
VVVDLSAPNLAKEMHVGHLRSTIIGDGVANVLEFLGDTVIRQNHVGDWGTQFGMLLAYLQ
EKPATSDELSDLENFYRAAKQRFDESEEFAERARGLVVKLQAGDAECLALWTRFKDISLS
HCQETYERLNVKLTPADVMGESAYNDDLANVVNDLKATGLLVESNGAQCVFLEEFRTADD
TPLPVIVQKAGGGYLYATTDLAAIRYRSKVLKADRVLYFVDQRQALHFQQVFEVARRAGF
VHDGMQLEHMGFGTMNGADGRPFKTRDGGTVKLIDLLDEAEERAYTLVREKNPEVAEAEL
RSIAKAVGISAVKYADLSKHRASDYSFNFDQMLSFEGNTAPYLLYAYTRVAGVFRKLGSA
FDASKGQIVLAAPQEQELAARLAQFTETLNNVAEKGTPHVLCAYLYDLAGLFSSFYENCP
ILGAENPDQQQSRLRLAALTGRTLKQGLDLLGLETLERM