Protein Info for Psyr_0394 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Heat shock protein HslU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 3 to 445 (443 residues), 701.2 bits, see alignment E=2.8e-215 PF07728: AAA_5" amino acids 51 to 87 (37 residues), 24.8 bits, see alignment 5.7e-09 PF00004: AAA" amino acids 52 to 136 (85 residues), 33.4 bits, see alignment E=1.7e-11 amino acids 201 to 330 (130 residues), 31.5 bits, see alignment E=6.9e-11 PF07724: AAA_2" amino acids 189 to 327 (139 residues), 92.8 bits, see alignment E=7.6e-30

Best Hits

Swiss-Prot: 100% identical to HSLU_PSEU2: ATP-dependent protease ATPase subunit HslU (hslU) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to psb:Psyr_0394)

MetaCyc: 72% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZF8 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psyr_0394 Heat shock protein HslU (Pseudomonas syringae pv. syringae B728a ΔmexB)
MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRVEVTPKNILMIGPTGV
GKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLADAAIKLLREQEIVKVRH
RAEDAAEERILDALLPPARVGFNEDPAQSSDSNTRQLFRKRLREGQLDDKEIEIEINEAV
GVDISAPPGMEEMTNQLQSLFANMGKGKTKSRKLKVKEALKLVREEEAGRLVNEEELKAK
ALEAVEQHGIVFIDEIDKVAKRGNSGGVDVSREGVQRDLLPLIEGCTVNTKLGMVKTDHI
LFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFERILSEPHASLTEQYRELLKTE
GLKIEFKPEGIKRLAEIAWQVNEKTENIGARRLHTLLERLLEEVSFSAGDLAISPDAAPI
EIDAEYVNSHLGDLAENEDLSRYIL