Protein Info for Psyr_0345 in Pseudomonas syringae pv. syringae B728a ΔmexB

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 35 to 355 (321 residues), 244.2 bits, see alignment E=8.5e-77 PF16576: HlyD_D23" amino acids 57 to 266 (210 residues), 50.7 bits, see alignment E=2.1e-17 PF13533: Biotin_lipoyl_2" amino acids 66 to 106 (41 residues), 27.9 bits, see alignment 2.4e-10 PF13437: HlyD_3" amino acids 171 to 271 (101 residues), 44.5 bits, see alignment E=3.4e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_0345)

Predicted SEED Role

"Efflux membrane fusion protein, RND family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZZK5 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Psyr_0345 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a ΔmexB)
MKRRSCLLLGSLLLSGVLLSGCGKDEAPPEPVRPVVFVEVRPESNQDFGRFAGNIQARYQ
SVLGFRVAGRIARRDVDVGAEVKKGDLLATLDPTDQQNTVRARQGDLANVQAQLINAQAN
ARRQQELFDRGVGAQAQLDIALTDLKTASSSQEQAKAAAQQARDQLSYSELRSDHDAVVT
EWKVEAGQVVTAGQEVVTLAQPDIKEAVIDLPDTLADQLPSDVVFTVASQLNPEVNTTAT
IREIEPQADRTTRTRRARLSLAQTPAAFRLGTAISVTLSSTITPRMRLPINALQEVDGKR
QVWIVDSQSQTVNPRAVTIASRDSDSFVLTDGVKAGEKVVSAGVNSLKPGQKVKVDEESP
R